PDB entry 2p5x

View 2p5x on RCSB PDB site
Description: Crystal structure of Maf domain of human N-acetylserotonin O-methyltransferase-like protein
Class: cell cycle
Keywords: asmtl, Structural Genomics, Structural Genomics Consortium, SGC, CELL CYCLE
Deposited on 2007-03-16, released 2007-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylserotonin O-methyltransferase-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ASMTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p5xa_
  • Chain 'B':
    Compound: N-acetylserotonin O-methyltransferase-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ASMTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p5xb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p5xA (A:)
    llhkrvvlasasprrqeilsnaglrfevvpskfkekldkasfatpygyametakqkalev
    anrlyqkdlrapdvvigadtivtvgglilekpvdkqdayrmlsrlsgrehsvftgvaivh
    csskdhqldtrvsefyeetkvkfselseellweyvhsgepmdkaggygiqalggmlvesv
    hgdflnvvgfplnhfckqlvklyypprpedlrrsvkhdsipaadtfedls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p5xA (A:)
    llhkrvvlasasprrqeilsnaglrfevvpskfkekldkasfatpygyametakqkalev
    anrlyqkdlrapdvvigadtivtvgglilekpvdkqdayrmlsrlsgrehsvftgvaivh
    csskdhqldtrvsefyeetkvkfselseellweyvhsgepmdkaggygiqalggmlvesv
    hgdflnvvgfplnhfckqlvklyy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p5xB (B:)
    llhkrvvlasasprrqeilsnaglrfevvpskfkekldkasfatpygyametakqkalev
    anrlyqkdlrapdvvigadtivtvgglilekpvdkqdayrmlsrlsgrehsvftgvaivh
    csskdhqldtrvsefyeetkvkfselseellweyvhsgepmdkaggygiqalggmlvesv
    hgdflnvvgfplnhfckqlvklyypprpedlrrsvkhdsipaadtfedls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p5xB (B:)
    llhkrvvlasasprrqeilsnaglrfevvpskfkekldkasfatpygyametakqkalev
    anrlyqkdlrapdvvigadtivtvgglilekpvdkqdayrmlsrlsgrehsvftgvaivh
    csskdhqldtrvsefyeetkvkfselseellweyvhsgepmdkaggygiqgmlvesvhgd
    flnvvgfplnhfckqlvklyy