PDB entry 2p5s

View 2p5s on RCSB PDB site
Description: RAB domain of human RASEF in complex with GDP
Class: signaling protein
Keywords: G-PROTEIN, RAB, GDP, STRUCTURAL GENOMICS, SGC, Structural Genomics Consortium, SIGNALING PROTEIN
Deposited on 2007-03-16, released 2007-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.211
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAS and EF-hand domain containing
    Species: Homo sapiens [TaxId:9606]
    Gene: RASEF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p5sa_
  • Chain 'B':
    Compound: RAS and EF-hand domain containing
    Species: Homo sapiens [TaxId:9606]
    Gene: RASEF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p5sb_
  • Heterogens: GDP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p5sA (A:)
    mgsshhhhhhssglvprgsaksfssqkaykivlagdaavgkssflmrlcknefrenisat
    lgvdfqmktlivdgertvlqlwdtagqerfrsiaksyfrkadgvlllydvtceksflnir
    ewvdmiedaahetvpimlvgnkadirdtaategqkcvpghfgeklamtygalfcetsakd
    gsniveavlhlarevkkrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p5sA (A:)
    aykivlagdaavgkssflmrlcknefrfqmktlivdgertvlqlwdtagqerfrsiaksy
    frkadgvlllydvtceksflnirewvdmiedaavpimlvgnkadirdtaategqkcvpgh
    fgeklamtygalfcetsakdgsniveavlhlarevkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p5sB (B:)
    mgsshhhhhhssglvprgsaksfssqkaykivlagdaavgkssflmrlcknefrenisat
    lgvdfqmktlivdgertvlqlwdtagqerfrsiaksyfrkadgvlllydvtceksflnir
    ewvdmiedaahetvpimlvgnkadirdtaategqkcvpghfgeklamtygalfcetsakd
    gsniveavlhlarevkkrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p5sB (B:)
    aykivlagdaavgkssflmrlcknefrgvdfqmktlivdgertvlqlwdtagqerfrsia
    ksyfrkadgvlllydvtceksflnirewvdmiedaavpimlvgnkadirdtaategqkcv
    pghfgeklamtygalfcetsakdgsniveavlhlarevkkr