PDB entry 2p5l

View 2p5l on RCSB PDB site
Description: Crystal structure of a dimer of N-terminal domains of AhrC in complex with an 18bp DNA operator site
Class: transcription repressor
Keywords: DNA-binding domain, winged helix-turn-helix, ARG box, protein-DNA complex, transcription repressor
Deposited on 2007-03-15, released 2008-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.208
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*dcp*dap*dtp*dgp*dap*dap*dtp*dap*dap*dap*dap*dap*dtp*dtp*dcp*dap*dap*dg)-3')
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: DNA (5'-d(*dcp*dtp*dtp*dgp*dap*dap*dtp*dtp*dtp*dtp*dtp*dap*dtp*dtp*dcp*dap*dtp*dg)-3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: Arginine repressor
    Species: Bacillus subtilis [TaxId:1423]
    Gene: argR, ahrC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p5lc1
  • Chain 'D':
    Compound: Arginine repressor
    Species: Bacillus subtilis [TaxId:1423]
    Gene: argR, ahrC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p5ld1
  • Chain 'E':
    Compound: DNA (5'-d(*dcp*dap*dtp*dgp*dap*dap*dtp*dap*dap*dap*dap*dap*dtp*dtp*dcp*dap*dap*dg)-3')
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: DNA (5'-d(*dcp*dtp*dtp*dgp*dap*dap*dtp*dtp*dtp*dtp*dtp*dap*dtp*dtp*dcp*dap*dtp*dg)-3')
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: Arginine repressor
    Species: Bacillus subtilis [TaxId:1423]
    Gene: argR, ahrC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p5lg1
  • Chain 'H':
    Compound: Arginine repressor
    Species: Bacillus subtilis [TaxId:1423]
    Gene: argR, ahrC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p5lh1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p5lC (C:)
    mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
    kysl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p5lC (C:)
    nkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyk
    ysl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p5lD (D:)
    mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
    kysl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2p5lG (G:)
    mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
    kysl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p5lG (G:)
    nkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyk
    ysl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p5lH (H:)
    mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
    kysl