PDB entry 2p5a

View 2p5a on RCSB PDB site
Description: Second binding site for a p38a kinase inhibitor
Class: transferase
Keywords: transferase, map kinase, serine/threonine-protein kinase, p38, isoform-2
Deposited on 2007-03-14, released 2008-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p5aa_
  • Heterogens: GG5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p5aA (A:)
    gpmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrp
    fqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivk
    cqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtdde
    mtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrl
    vgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkrit
    aaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeem
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p5aA (A:)
    rptfyrqelnktiwevperyqnlspvgsgsvcaafdtktglrvavkklsrpfqsiihakr
    tyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivltddhvqfli
    yqilrglkyihsadiihrdlkpsnlavnedcelkildfgtrwyrapeimlnwmhynqtvd
    iwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqm
    pkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydq
    sfesrdllidewksltydevisfvppp