PDB entry 2p56

View 2p56 on RCSB PDB site
Description: Crystal structure of alpha-2,3-sialyltransferase from Campylobacter jejuni in apo form
Class: transferase
Keywords: mixed alpha beta, TRANSFERASE
Deposited on 2007-03-14, released 2007-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-2,3-sialyltransferase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: cst-I
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p56a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p56A (A:)
    gshmtrtrmenelivsknmqniiiagngpslkninykrlpreydvfrcnqfyfedkyylg
    kkikavffnpgvflqqyhtakqlilkneyeiknifcstfnlpfiesndflhqfynffpda
    klgyevienlkefyayikyneiyfnkritsgvymcaiaialgyktiylcgidfyegdviy
    pfeamstniktifpgikdfkpsnchskeydiealkllksiykvniyalcddsilanhfpl
    sininnnftlenkhnnsindilltdntpgvsfyknqlkadnkimlnfy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p56A (A:)
    rmenelivsknmqniiiagngpslkninykrlpreydvfrcnqfyfedkyylgkkikavf
    fnpgvflqqyhtakqlilkneyeiknifcstfnlpfiesndflhqfynffpdaklgyevi
    enlkefyayikyneiyfnkritsgvymcaiaialgyktiylcgidfmstniktifpginc
    hskeydiealkllksiykvniyalcddsilanhfplsininnnftlenkhnnsindillt
    dntpgvsfyknqlkadn