PDB entry 2p50

View 2p50 on RCSB PDB site
Description: Crystal structure of N-acetyl-D-Glucosamine-6-Phosphate deacetylase liganded with Zn
Class: hydrolase
Keywords: N-acetyl-d-glucosamine-6-phosphate deacetylase, amidohydrolase, (beta/alpha)8-barrel, HYDROLASE
Deposited on 2007-03-14, released 2007-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Escherichia coli [TaxId:83333]
    Gene: nagA, b0677, JW0663
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p50a1, d2p50a2
  • Chain 'B':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Escherichia coli [TaxId:83333]
    Gene: nagA, b0677, JW0663
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p50b1, d2p50b2
  • Chain 'C':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Escherichia coli [TaxId:83333]
    Gene: nagA, b0677, JW0663
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p50c1, d2p50c2
  • Chain 'D':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Escherichia coli [TaxId:83333]
    Gene: nagA, b0677, JW0663
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p50d1, d2p50d2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p50A (A:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlapemvpaev
    isklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildead
    iycgiiadglhvdyanirnakrlkgdklclvtdatapaganieqfifagktiyyrnglcv
    dengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlgtlaagkvanl
    taftpdfkitktivngnevvtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p50B (B:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlapemvpaev
    isklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildead
    iycgiiadglhvdyanirnakrlkgdklclvtdatapaganieqfifagktiyyrnglcv
    dengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlgtlaagkvanl
    taftpdfkitktivngnevvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p50B (B:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlapemvpaev
    isklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildead
    iycgiiadglhvdyanirnakrlkgdklclvtdatapagasgssltmiegvrnlvehcgi
    aldevlrmatlyparaigvekrlgtlaagkvanltaftpdfkitktivngnevvtq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p50C (C:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlapemvpaev
    isklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildead
    iycgiiadglhvdyanirnakrlkgdklclvtdatapaganieqfifagktiyyrnglcv
    dengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlgtlaagkvanl
    taftpdfkitktivngnevvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p50C (C:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlapemvpaev
    isklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildead
    iycgiiadglhvdyanirnakrlkgdklclvtdatapagagssltmiegvrnlvehcgia
    ldevlrmatlyparaigvekrlgtlaagkvanltaftpdfkitktivngnevvtq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p50D (D:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlapemvpaev
    isklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildead
    iycgiiadglhvdyanirnakrlkgdklclvtdatapaganieqfifagktiyyrnglcv
    dengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlgtlaagkvanl
    taftpdfkitktivngnevvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p50D (D:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlapemvpaev
    isklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildead
    iycgiiadglhvdyanirnakrlkgdklclvtdatapasgssltmiegvrnlvehcgial
    devlrmatlyparaigvekrlgtlaagkvanltaftpdfkitktivngnevvtq