PDB entry 2p4u

View 2p4u on RCSB PDB site
Description: Crystal structure of acid phosphatase 1 (Acp1) from Mus musculus
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, HYDROLASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2007-03-13, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acid phosphatase 1
    Species: MUS MUSCULUS [TaxId:10090]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p4ua_
  • Chain 'B':
    Compound: Acid phosphatase 1
    Species: MUS MUSCULUS [TaxId:10090]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p4ub_
  • Chain 'C':
    Compound: Acid phosphatase 1
    Species: MUS MUSCULUS [TaxId:10090]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p4uc_
  • Chain 'D':
    Compound: Acid phosphatase 1
    Species: MUS MUSCULUS [TaxId:10090]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p4ud_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p4uA (A:)
    mslaevgsksvlfvclgnicrspiaeavfrklvtdekvsdnwaidssavsdwnvgrppdp
    ravsclrnhgistahkarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellg
    sydpqkqliiedpyygndsdfevvyqqclrcckaflektyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4uA (A:)
    sksvlfvclgnicrspiaeavfrklvtdekvsdnwaidssavsdwnvgrppdpravsclr
    nhgistahkarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellgsydpqkq
    liiedpyygndsdfevvyqqclrcckaflekty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p4uB (B:)
    mslaevgsksvlfvclgnicrspiaeavfrklvtdekvsdnwaidssavsdwnvgrppdp
    ravsclrnhgistahkarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellg
    sydpqkqliiedpyygndsdfevvyqqclrcckaflektyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4uB (B:)
    sksvlfvclgnicrspiaeavfrklvtdekvsdnwaidssavsdwnvgrppdpravsclr
    nhgistahkarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellgsydpqkq
    liiedpyygndsdfevvyqqclrcckaflekty
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p4uC (C:)
    mslaevgsksvlfvclgnicrspiaeavfrklvtdekvsdnwaidssavsdwnvgrppdp
    ravsclrnhgistahkarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellg
    sydpqkqliiedpyygndsdfevvyqqclrcckaflektyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4uC (C:)
    sksvlfvclgnicrspiaeavfrklvtdekvsdnwaidssavsdwnvgrppdpravsclr
    nhgistahkarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellgsydpqkq
    liiedpyygndsdfevvyqqclrcckaflekty
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p4uD (D:)
    mslaevgsksvlfvclgnicrspiaeavfrklvtdekvsdnwaidssavsdwnvgrppdp
    ravsclrnhgistahkarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellg
    sydpqkqliiedpyygndsdfevvyqqclrcckaflektyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4uD (D:)
    sksvlfvclgnicrspiaeavfrklvtdekvsdnwaidssavsdwnvgrppdpravsclr
    nhgistahkarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellgsydpqkq
    liiedpyygndsdfevvyqqclrcckaflekty