PDB entry 2p4t

View 2p4t on RCSB PDB site
Description: Structure of the Q67H mutant of R67 dihydrofolate reductase-NADP+ complex reveals a novel cofactor binding mode
Class: oxidoreductase
Keywords: bacterial infections, crystal structure, folate metabolism, NADP+, R67 DHFR, Symmetric binding, trimethoprim-resistance, OXIDOREDUCTASE
Deposited on 2007-03-13, released 2007-06-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.193
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrofolate reductase type 2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00383 (Start-61)
      • engineered (50)
    Domains in SCOPe 2.01: d2p4ta_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p4tA (A:)
    vfpsnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvhiypvaaler
    in
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4tA (A:)
    natfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvhiypvaalerin