PDB entry 2p4n

View 2p4n on RCSB PDB site
Description: Human Monomeric Kinesin (1BG2) and Bovine Tubulin (1JFF) Docked into the 9-Angstrom Cryo-EM Map of Nucleotide-Free Kinesin Complexed to the Microtubule
Class: transport protein
Keywords: Motor protein, ATPase, TRANSPORT PROTEIN
Deposited on 2007-03-12, released 2008-07-08
The last revision prior to the SCOP 1.75 freeze date was dated 2008-07-08, with a file datestamp of 2008-07-03.
Experiment type: EM
Resolution: 9 Å
R-factor: N/A
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin alpha chain
    Species: BOS TAURUS
    Domains in SCOP 1.75: d2p4na1
  • Chain 'B':
    Compound: Tubulin beta chain
    Species: BOS TAURUS
    Domains in SCOP 1.75: d2p4nb1
  • Chain 'K':
    Compound: kinesin heavy chain
    Species: HOMO SAPIENS
  • Heterogens: MG, ZN, ADP, GTP, TA1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p4nA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprahfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4nA (A:)
    recisihvgqagvqignacwelyclehgiqpdghvpravfvdleptvidevrtgtyrqlf
    hpeqlitgkedaannyarghytigkeiidlvldrirkladqctglqgfsvfhsfgggtgs
    gftsllmerlsvdygkksklefsiypapqvstavvepynsiltthttlehsdcafmvdne
    aiydicrrnldierptytnlnrligqivssitaslrfdgalnvdltefqtnlvpyprahf
    platyapvisaekayheqlsvaeitnacfepanqmvkcdprhgkymaccllyrgdvvpkd
    vnaaiatiktkrtiqfvdwcptgfkvginyepptvvpggdlakvqravcmlsnttaiaea
    warldhkfdlmyakrafvhwyvgegmeegefsearedmaalekdyeevgvds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p4nB (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeegeedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4nB (B:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
    pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmma
    acdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprgl
    kmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvse
    yqqyqd
    

  • Chain 'K':
    No sequence available.