PDB entry 2p4i

View 2p4i on RCSB PDB site
Description: Evolution of a highly Selective and Potent 2-(Pyridin-2-yl)-1,3,5-triazine Tie-2 Kinase Inhibitor
Class: Transferase
Keywords: Tie-2 Kinase Inhibitor triazine, Transferase
Deposited on 2007-03-12, released 2007-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.248
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Angiopoietin-1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: TEK, TIE2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p4ia_
  • Chain 'B':
    Compound: Angiopoietin-1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: TEK, TIE2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p4ib_
  • Heterogens: MR9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p4iA (A:)
    knnpdptiypvldwndikfqdvigegnfgqvlkarikkdglrmdaaikrmkeyaskddhr
    dfagelevlcklghhpniinllgacehrgylylaieyaphgnlldflrksrvletdpafa
    ianstastlssqqllhfaadvargmdylsqkqfihrdlaarnilvgenyvakiadfglsr
    gqevyvkktmgrlpvrwmaieslnysvyttnsdvwsygvllweivslggtpycgmtcael
    yeklpqgyrlekplncddevydlmrqcwrekpyerpsfaqilvslnrmleerktyvnttl
    yekftyagidcsaeeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4iA (A:)
    vlkarirmdaaikrgelevlcklghhpniinllgacehylaieyaphgnlldflrksrvl
    etdpafaianstastlssqqllhfaadvargmdylsqkqfihrdlaarnilvgenyvaki
    adfglsrvkktmgrlpvrwmaieslnysvyttnsdvwsygvllweivslggtpycgmtca
    elyeklpqgyrlekplncddevydlmrqcwrekpyerpsfaqilvslnrmleerktyvnt
    tlyekftyagid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p4iB (B:)
    knnpdptiypvldwndikfqdvigegnfgqvlkarikkdglrmdaaikrmkeyaskddhr
    dfagelevlcklghhpniinllgacehrgylylaieyaphgnlldflrksrvletdpafa
    ianstastlssqqllhfaadvargmdylsqkqfihrdlaarnilvgenyvakiadfglsr
    gqevyvkktmgrlpvrwmaieslnysvyttnsdvwsygvllweivslggtpycgmtcael
    yeklpqgyrlekplncddevydlmrqcwrekpyerpsfaqilvslnrmleerktyvnttl
    yekftyagidcsaeeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4iB (B:)
    gqvlkarirmdaaikrmkekddhrdfagelevlcklghhpniinllgacehylaieyaph
    gnlldflrksrvletdpafaianstastlssqqllhfaadvargmdylsqkqfihrdlaa
    rnilvgenyvakiadfglgrlpvrwmaieslnysvyttnsdvwsygvllweivslggtpy
    cgmtcaelyeklpqgyrlekplncddevydlmrqcwrekpyerpsfaqilvslnrmleer
    ktyvnttlyekftyagid