PDB entry 2p4h

View 2p4h on RCSB PDB site
Description: Crystal Structure of Vestitone Reductase from Alfalfa (Medicago sativa L.)
Class: plant protein
Keywords: NADPH-dependent reductase, crystal structure, isoflavonoid, PLANT PROTEIN
Deposited on 2007-03-12, released 2007-05-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.188
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Vestitone reductase
    Species: Medicago sativa [TaxId:3879]
    Gene: Vestitone Reductase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2p4hx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2p4hX (X:)
    kgrvcvtggtgflgswiiksllengysvnttiradperkrdvsfltnlpgaseklhffna
    dlsnpdsfaaaiegcvgifhtaspidfavsepeeivtkrtvdgalgilkacvnsktvkrf
    iytssgsavsfngkdkdvldesdwsdvdllrsvkpfgwnyavsktlaekavlefgeqngi
    dvvtlilpfivgrfvcpklpdsiekalvlvlgkkeqigvtrfhmvhvddvarahiyllen
    svpggryncspfivpieemsqllsakypeyqiltvdelkeikgarlpdlntkklvdagfd
    fkytiedmfddaiqcckekgyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4hX (X:)
    kgrvcvtggtgflgswiiksllengysvnttiradrdvsfltnlpgaseklhffnadlsn
    pdsfaaaiegcvgifhtaspieivtkrtvdgalgilkacvnsktvkrfiytssgsavsfn
    gkdkdvldesdwsdvdllrsvkpfgwnyavsktlaekavlefgeqngidvvtlilpfivg
    rfvcpklpdsiekalvlvlgkkeqigvtrfhmvhvddvarahiyllensvpggryncspf
    ivpieemsqllsakypeyqiltvdelkeikgarlpdlntkklvdagfdfkytiedmfdda
    iqcckekgyl