PDB entry 2p3y

View 2p3y on RCSB PDB site
Description: Crystal structure of VPA0735 from Vibrio parahaemolyticus. NorthEast Structural Genomics target VpR109
Class: structural genomics, unknown function
Keywords: Hypothetical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2007-03-10, released 2007-03-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.204
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein VPA0735
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: VPA0735
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87I71
      • modified residue (44)
      • modified residue (47)
      • modified residue (51)
      • modified residue (70)
      • modified residue (87)
      • modified residue (130)
      • modified residue (133-134)
      • modified residue (262)
      • modified residue (296)
      • modified residue (351)
      • modified residue (406)
      • modified residue (468)
      • modified residue (475)
    Domains in SCOPe 2.01: d2p3ya1
  • Chain 'B':
    Compound: Hypothetical protein VPA0735
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: VPA0735
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87I71
      • modified residue (44)
      • modified residue (47)
      • modified residue (51)
      • modified residue (70)
      • modified residue (87)
      • modified residue (130)
      • modified residue (133-134)
      • modified residue (262)
      • modified residue (296)
      • modified residue (351)
      • modified residue (406)
      • modified residue (468)
      • modified residue (475)
    Domains in SCOPe 2.01: d2p3yb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p3yA (A:)
    mkkrilavavtsmllsasvfaqetvvpsrvgdlkfesdfptqetmknmlnemdfqratqa
    ylwgipassimewlnvsrndfkfeegqmgffntlkqkqgiitanfttpyvigtwnlektg
    pliinlpeakmagmmldvhqrvlsdlsllgpdkgkggkylivppgekykdlnpkgyyvir
    pktnvvyggirilepdvdrvvkqvvpnittqpyadgklgrkipvaqvpeidwthipkdgl
    eywktihqiiqenpveerdrfvmaqlkflgiekgkpfnpteeqkkilleaskvgramaqs
    ndytkrftqpywkgtnwkdaisvsldqrsenydelderaawfyeaitvsrgmkstipgfg
    qrylvtyqdsdgnwlsgehtyklhvpanvpasnfwsttvydennrlmiindagspdissr
    knlkvnsdgsidvyygpkpvkgyennwvqtnpgegwftyfrfygptekmfdkswtmgdie
    lvklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p3yA (A:)
    qetvvpsrvgdlkfesdfptqetmknmlnemdfqratqaylwgipassimewlnvsrndf
    kfeegqmgffntlkqkqgiitanfttpyvigtwnlektgpliinlpeakmagmmldvhqr
    vlsdlsllgpdkgkggkylivppgekykdlnpkgyyvirpktnvvyggirilepdvdrvv
    kqvvpnittqpyadgklgrkipvaqvpeidwthipkdgleywktihqiiqenpveerdrf
    vmaqlkflgiekgkpfnpteeqkkilleaskvgramaqsndytkrftqpywkgtnwkdai
    svsldqrsenydelderaawfyeaitvsrgmkstipgfgqrylvtyqdsdgnwlsgehty
    klhvpanvpasnfwsttvydennrlmiindagspdissrknlkvnsdgsidvyygpkpvk
    gyennwvqtnpgegwftyfrfygptekmfdkswtmgdielv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p3yB (B:)
    mkkrilavavtsmllsasvfaqetvvpsrvgdlkfesdfptqetmknmlnemdfqratqa
    ylwgipassimewlnvsrndfkfeegqmgffntlkqkqgiitanfttpyvigtwnlektg
    pliinlpeakmagmmldvhqrvlsdlsllgpdkgkggkylivppgekykdlnpkgyyvir
    pktnvvyggirilepdvdrvvkqvvpnittqpyadgklgrkipvaqvpeidwthipkdgl
    eywktihqiiqenpveerdrfvmaqlkflgiekgkpfnpteeqkkilleaskvgramaqs
    ndytkrftqpywkgtnwkdaisvsldqrsenydelderaawfyeaitvsrgmkstipgfg
    qrylvtyqdsdgnwlsgehtyklhvpanvpasnfwsttvydennrlmiindagspdissr
    knlkvnsdgsidvyygpkpvkgyennwvqtnpgegwftyfrfygptekmfdkswtmgdie
    lvklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p3yB (B:)
    qetvvpsrvgdlkfesdfptqetmknmlnemdfqratqaylwgipassimewlnvsrndf
    kfeegqmgffntlkqkqgiitanfttpyvigtwnlektgpliinlpeakmagmmldvhqr
    vlsdlsllgpdkgkggkylivppgekykdlnpkgyyvirpktnvvyggirilepdvdrvv
    kqvvpnittqpyadgklgrkipvaqvpeidwthipkdgleywktihqiiqenpveerdrf
    vmaqlkflgiekgkpfnpteeqkkilleaskvgramaqsndytkrftqpywkgtnwkdai
    svsldqrsenydelderaawfyeaitvsrgmkstipgfgqrylvtyqdsdgnwlsgehty
    klhvpanvpasnfwsttvydennrlmiindagspdissrknlkvnsdgsidvyygpkpvk
    gyennwvqtnpgegwftyfrfygptekmfdkswtmgdielv