PDB entry 2p3w

View 2p3w on RCSB PDB site
Description: Crystal Structure of the HtrA3 PDZ Domain Bound to a Phage-Derived Ligand (FGRWV)
Class: Protein Binding
Keywords: PDZ DOMAIN, PHAGE DERIVED HIGH AFFINITY LIGAND, Protein Binding
Deposited on 2007-03-09, released 2007-11-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable serine protease HTRA3
    Species: Homo sapiens [TaxId:9606]
    Gene: HTRA3, PRSP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83110 (4-103)
      • expression tag (0-3)
      • linker (104-106)
      • see remark 999 (107-111)
    Domains in SCOPe 2.01: d2p3wa_
  • Chain 'B':
    Compound: Probable serine protease HTRA3
    Species: Homo sapiens [TaxId:9606]
    Gene: HTRA3, PRSP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83110 (4-103)
      • expression tag (0-3)
      • linker (104-106)
      • see remark 999 (107-111)
    Domains in SCOPe 2.01: d2p3wb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p3wA (A:)
    gshmkrfigirmrtitpslvdelkasnpdfpevssgiyvqevapnspsqrggiqdgdiiv
    kvngrplvdsselqeavltesplllevrrgnddllfsiapevvmgggfgrwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p3wA (A:)
    gshmkrfigirmrtitpslvdelkasnpdfvssgiyvqevapnspsqrggiqdgdiivkv
    ngrplvdsselqeavltesplllevrrgnddllfsiapevvmgggfgrwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p3wB (B:)
    gshmkrfigirmrtitpslvdelkasnpdfpevssgiyvqevapnspsqrggiqdgdiiv
    kvngrplvdsselqeavltesplllevrrgnddllfsiapevvmgggfgrwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p3wB (B:)
    gshmkrfigirmrtitpslvdepevssgiyvqevapnspsqrggiqdgdiivkvngrplv
    dsselqeavltesplllevrrgnddllfsiapevvmgggfgrwv