PDB entry 2p3m

View 2p3m on RCSB PDB site
Description: Solution structure of Mj0056
Class: transferase
Keywords: RIFT barrel, phosphotransferase, riboflavin kinase
Deposited on 2007-03-09, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Riboflavin Kinase MJ0056
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0056
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60365 (0-135)
  Domains in SCOPe 2.08: d2p3ma1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2p3mA (A:)
  mvklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyi
  etedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnl
  kdgdvikilikgdkde