PDB entry 2p3j

View 2p3j on RCSB PDB site
Description: Crystal structure of the Arg101Ala mutant protein of Rhesus rotavirus VP8*
Class: viral protein
Keywords: beta-sandwich, VIRAL PROTEIN
Deposited on 2007-03-09, released 2008-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vp4
  Species: Rotavirus A [TaxId:10969]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q91HI9 (0-160)
    • engineered mutation (37)
  Domains in SCOPe 2.07: d2p3ja_
• Heterogens: SO4, MNA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2p3jA (A:)
  vldgpyqpttfnppvdywmllaptaagvvvegtnntdawlatilvepnvtsetrsytlfg
  tqeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpn
  vttkyysttnydsvnmtafcdfyiipreeestcteyinngl