PDB entry 2p3b
View 2p3b on RCSB PDB site
Description: Crystal Structure of the subtype B wild type HIV protease complexed with TL-3 inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: wild type subtype B HIV protease, TL-3 inhibitor, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on
2007-03-08, released
2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-18, with a file datestamp of
2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2p3ba_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2p3bb_ - Heterogens: 3TL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2p3bA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2p3bB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf