PDB entry 2p3b

View 2p3b on RCSB PDB site
Description: Crystal Structure of the subtype B wild type HIV protease complexed with TL-3 inhibitor
Class: hydrolase
Keywords: protease-inhibitor complex, wild type subtype B HIV protease, TL-3 inhibitor
Deposited on 2007-03-08, released 2007-04-24
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-29, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.165
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus type 1
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
    Domains in SCOP 1.73: d2p3ba1
  • Chain 'B':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus type 1
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • modified residue (66)
    Domains in SCOP 1.73: d2p3bb1
  • Heterogens: 3TL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p3bA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p3bB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf