PDB entry 2p3a

View 2p3a on RCSB PDB site
Description: Crystal Structure of the multi-drug resistant mutant subtype B HIV protease complexed with TL-3 inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: multi-drug resistant mutant subtype B HIV protease, TL-3 inhibitor, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2007-03-08, released 2007-04-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2p3aa_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2p3ab_
  • Heterogens: 3TL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p3aA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemalpgkwkprmiggiggfvkvrqyd
    qipieicghkvigtvlvgptpaniigrnlmtqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p3aB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemalpgkwkprmiggiggfvkvrqyd
    qipieicghkvigtvlvgptpaniigrnlmtqigctlnf