PDB entry 2p3a
View 2p3a on RCSB PDB site
Description: Crystal Structure of the multi-drug resistant mutant subtype B HIV protease complexed with TL-3 inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: multi-drug resistant mutant subtype B HIV protease, TL-3 inhibitor, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on
2007-03-08, released
2007-04-24
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.185
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2p3aa_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2p3ab_ - Heterogens: 3TL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2p3aA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvleemalpgkwkprmiggiggfvkvrqyd
qipieicghkvigtvlvgptpaniigrnlmtqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2p3aB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvleemalpgkwkprmiggiggfvkvrqyd
qipieicghkvigtvlvgptpaniigrnlmtqigctlnf