PDB entry 2p30

View 2p30 on RCSB PDB site
Description: Crystal structure of TTHB049 from Thermus thermophilus HB8
Class: hydrolase
Keywords: Thermus thermophilus HB8, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2007-03-08, released 2007-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.209
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-ribazole-5'-phosphate phosphatase
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q53WB3 (0-176)
    • engineered (169)
  Domains in SCOPe 2.08: d2p30a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2p30A (A:)
  melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
  lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
  leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlamdgeeatg