PDB entry 2p2y

View 2p2y on RCSB PDB site
Description: Crystal structure of TTHB049 from Thermus thermophilus HB8
Class: hydrolase
Keywords: HYDROLASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-08, released 2007-09-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.225
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-ribazole-5'-phosphate phosphatase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53WB3 (0-End)
      • engineered (4)
    Domains in SCOPe 2.05: d2p2ya_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p2yA (A:)
    melwmvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
    lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
    leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlaldgeeatg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2yA (A:)
    melwmvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
    lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
    leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlal