PDB entry 2p2t

View 2p2t on RCSB PDB site
Description: Crystal structure of dynein light chain LC8 bound to residues 123-138 of intermediate chain IC74
Class: transport protein
Keywords: protein - peptide complex, TRANSPORT PROTEIN
Deposited on 2007-03-07, released 2008-01-15
The last revision prior to the SCOP 1.75 freeze date was dated 2008-01-15, with a file datestamp of 2008-01-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dynein light chain 1, cytoplasmic
  Species: Drosophila melanogaster
  Gene: ctp, Cdlc1, ddlc1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q24117 (Start-88)
  Domains in SCOP 1.75: d2p2ta1
• Chain 'C':
  Compound: Dynein intermediate chain peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q24246
• Heterogens: ACT, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2p2tA (A:)
  msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
  nfgsyvthetrhfiyfylgqvaillfksg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2p2tA (A:)
  drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
  gsyvthetrhfiyfylgqvaillfksg
  

  
  
• Chain 'C':
  No sequence available.