PDB entry 2p2t
View 2p2t on RCSB PDB site
Description: Crystal structure of dynein light chain LC8 bound to residues 123-138 of intermediate chain IC74
Class: transport protein
Keywords: protein - peptide complex, TRANSPORT PROTEIN
Deposited on
2007-03-07, released
2008-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-18, with a file datestamp of
2017-10-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Dynein light chain 1, cytoplasmic
Species: Drosophila melanogaster [TaxId:7227]
Gene: ctp, Cdlc1, ddlc1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2p2ta1 - Chain 'C':
Compound: Dynein intermediate chain peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: ACT, NA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2p2tA (A:)
msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetrhfiyfylgqvaillfksg
Sequence, based on observed residues (ATOM records): (download)
>2p2tA (A:)
drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetrhfiyfylgqvaillfksg
- Chain 'C':
No sequence available.