PDB entry 2p2t

View 2p2t on RCSB PDB site
Description: Crystal structure of dynein light chain LC8 bound to residues 123-138 of intermediate chain IC74
Class: transport protein
Keywords: protein - peptide complex, TRANSPORT PROTEIN
Deposited on 2007-03-07, released 2008-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: ctp, Cdlc1, ddlc1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p2ta1
  • Chain 'C':
    Compound: Dynein intermediate chain peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p2tA (A:)
    msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
    nfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2tA (A:)
    drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
    gsyvthetrhfiyfylgqvaillfksg
    

  • Chain 'C':
    No sequence available.