PDB entry 2p2r

View 2p2r on RCSB PDB site
Description: Crystal structure of the third KH domain of human Poly(C)-Binding Protein-2 in complex with C-rich strand of human telomeric DNA
Class: RNA and DNA binding protein/DNA
Keywords: protein-DNA complex, RNA and DNA binding protein-DNA complex
Deposited on 2007-03-07, released 2007-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Poly(rC)-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: PCBP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15366
    • modified residue (32)
  Domains in SCOPe 2.07: d2p2ra_
• Chain 'B':
  Compound: C-rich strand of human telomeric DNA
  Species: synthetic, synthetic
  
• Heterogens: CYT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2p2rA (A:)
  kaqttsheltipndligciigrqgakineirqmsgaqikianpvegstdrqvtitgsaas
  islaqylinvrlsset
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2p2rA (A:)
  qttsheltipndligciigrqgakineirqmsgaqikianpvegstdrqvtitgsaasis
  laqylinvrlsse
  

  
  
• Chain 'B':
  No sequence available.