PDB entry 2p2r

View 2p2r on RCSB PDB site
Description: Crystal structure of the third KH domain of human Poly(C)-Binding Protein-2 in complex with C-rich strand of human telomeric DNA
Class: RNA and DNA binding protein/DNA
Keywords: protein-DNA complex, RNA and DNA binding protein-DNA complex
Deposited on 2007-03-07, released 2007-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(rC)-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366
      • modified residue (32)
    Domains in SCOPe 2.08: d2p2ra_
  • Chain 'B':
    Compound: C-rich strand of human telomeric DNA
    Species: synthetic, synthetic
  • Heterogens: CYT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p2rA (A:)
    kaqttsheltipndligciigrqgakineirqmsgaqikianpvegstdrqvtitgsaas
    islaqylinvrlsset
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2rA (A:)
    qttsheltipndligciigrqgakineirqmsgaqikianpvegstdrqvtitgsaasis
    laqylinvrlsse
    

  • Chain 'B':
    No sequence available.