PDB entry 2p2l

View 2p2l on RCSB PDB site
Description: Rac1-GDP-Zinc Complex
Class: unknown function
Keywords: Rho Family GTPase, UNKNOWN FUNCTION
Deposited on 2007-03-07, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (4-End)
      • conflict (81)
    Domains in SCOPe 2.07: d2p2la_
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (4-End)
      • conflict (81)
    Domains in SCOPe 2.07: d2p2lb_
  • Chain 'C':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (4-End)
      • conflict (81)
    Domains in SCOPe 2.07: d2p2lc_
  • Heterogens: ZN, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p2lA (A:)
    gsklmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
    dtagqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtk
    ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    lcpppvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2lA (A:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvgkpvnlglwdtagqed
    ydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrddk
    dtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p2lB (B:)
    gsklmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
    dtagqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtk
    ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    lcpppvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2lB (B:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgpvnlglwdtagq
    edydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
    dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p2lC (C:)
    gsklmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
    dtagqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtk
    ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    lcpppvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2lC (C:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcp