PDB entry 2p2h

View 2p2h on RCSB PDB site
Description: Crystal structure of the VEGFR2 kinase domain in complex with a pyridinyl-triazine inhibitor
Class: Transferase
Keywords: receptor tyrosine kinase, KDR, Transferase
Deposited on 2007-03-07, released 2007-03-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.205
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: KDR, FLK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35968 (0-124)
      • engineered (2)
      • engineered (101)
      • engineered (125)
      • cloning artifact (307)
      • expression tag (308-310)
    • Uniprot P35968 (125-306)
    Domains in SCOPe 2.02: d2p2ha_
  • Heterogens: 994, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p2hA (A:)
    ehaerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkega
    thsehralmselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrne
    fvpykvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvki
    cdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgas
    pypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnll
    qanaqqdrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2hA (A:)
    ehaerlpydaskwefprdrlklgkplgrqvieadafgidktatcrtvavkmlkegathse
    hralmselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefvpy
    kvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfg
    larlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegt
    rmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqanaqqdrhhh