PDB entry 2p2e

View 2p2e on RCSB PDB site
Description: Crystal structure of a putative Fe-S biosynthesis protein from Lactobacillus salivarius with novel protein fold
Class: structural genomics, unknown function
Keywords: hypothetical protein, beta-barrel, Fe-S biosynthesis, 10399l, Structural Genomics, Protein Structure Initiative, PSI-2, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2007-03-07, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.229
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative Fe-S biosynthesis protein
    Species: Lactobacillus salivarius [TaxId:362948]
    Gene: LSL_1730
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1WRG6 (3-119)
      • cloning artifact (2)
      • modified residue (57)
      • modified residue (82)
      • modified residue (84)
      • modified residue (88)
      • modified residue (110)
      • cloning artifact (120)
    Domains in SCOPe 2.07: d2p2ea1, d2p2ea2, d2p2ea3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2p2eA (A:)
mslkitvtddaakklqrytddsnavllldfddgvgalskvgvcslnsdfrilvvskdmdy
kkdynevidsnigkfyykgyskmymddnmkislntnnsllrltgdnsgelmpalsiqdfr
eghhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2p2eA (A:)
lkitvtddaakklqrytddsnavllldfddgvgalskvgvcslnsdfrilvvskdmdykk
dynevidsnigkfyykgyskmymddnmkislntnnsllrltgdnsgelmpalsiqdfre