PDB entry 2p2e

View 2p2e on RCSB PDB site
Description: Crystal structure of a putative Fe-S biosynthesis protein from Lactobacillus salivarius with novel protein fold
Class: structural genomics, unknown function
Keywords: crystal structure, hypothetical protein, beta-barrel, Fe-S biosynthesis, 10399l, Structural Genomics, Protein Structure Initiative, PSI-2, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2007-03-07, released 2007-03-20
The last revision prior to the SCOP 1.75 freeze date was dated 2007-03-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.229
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative Fe-S biosynthesis protein
  Species: Lactobacillus salivarius subsp. salivarius
  Gene: LSL_1730
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q1WRG6 (3-119)
    • cloning artifact (2)
    • modified residue (57)
    • modified residue (82)
    • modified residue (84)
    • modified residue (88)
    • modified residue (110)
    • cloning artifact (120)
  Domains in SCOP 1.75: d2p2ea1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2p2eA (A:)
  mslkitvtddaakklqrytddsnavllldfddgvgalskvgvcslnsdfrilvvskdmdy
  kkdynevidsnigkfyykgyskmymddnmkislntnnsllrltgdnsgelmpalsiqdfr
  eghhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2p2eA (A:)
  lkitvtddaakklqrytddsnavllldfddgvgalskvgvcslnsdfrilvvskdmdykk
  dynevidsnigkfyykgyskmymddnmkislntnnsllrltgdnsgelmpalsiqdfre