PDB entry 2p27

View 2p27 on RCSB PDB site
Description: Crystal Structure of Human Pyridoxal Phosphate Phosphatase with Mg2+ at 1.9 A resolution
Class: hydrolase
Keywords: Phosphatase, Structural Genomics, NYSGXRC, New York Structural Genomics Research Consortium, NYSGRC, New York SGX Research Center for Structural Genomics, PSI-2, Protein Structure Initiative, HYDROLASE
Deposited on 2007-03-07, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyridoxal phosphate phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDXP, PLP, PLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p27a_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p27A (A:)
    mslarcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaalfvs
    nnsrrarpelalrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlggegl
    raelraaglrlagdpsagdgaaprvravlvgydehfsfaklreacahlrdpecllvatdr
    dpwhplsdgsrtpgtgslaaavetasgrqalvvgkpspymfecitenfsidpartlmvgd
    rletdilfghrcgmttvltltgvsrleeaqaylaagqhdlvphyyvesiadltegledeg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p27A (A:)
    arcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaalfvsnns
    rrarpelalrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlggeglrae
    lraaglrlagdpsaaprvravlvgydehfsfaklreacahlrdpecllvatdrdpwhpls
    dgsrtpgtgslaaavetasgrqalvvgkpspymfecitenfsidpartlmvgdrletdil
    fghrcgmttvltltgvsrleeaqaylaagqhdlvphyyvesiadltegl