PDB entry 2p22

View 2p22 on RCSB PDB site
Description: Structure of the Yeast ESCRT-I Heterotetramer Core
Class: transport protein
Keywords: Endosome, Trafficking complex, Vps23, Vps28, Vps37, Mvb12, Vacuolar Protein Sorting, ESCRT protein complexes, Endosomal Sorting Complex Required for Transport, ESCRT-I, ubiquitin, Tsg101, TRANSPORT PROTEIN
Deposited on 2007-03-06, released 2007-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-15, with a file datestamp of 2020-04-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS23
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: vacuolar protein sorting-associated protein 28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPT28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p22b_
  • Chain 'C':
    Compound: protein srn2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS37
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99176 (0-191)
      • engineered (101)
  • Chain 'D':
    Compound: Hypothetical 12.0 kDa protein in ADE3-SER2 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Mvb12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42939 (1-78)
      • cloning artifact (0)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2p22B (B:)
mqkhniklnqnqdisqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkd
siddtqytntvdkllkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrlerg

    Sequence, based on observed residues (ATOM records): (download) 
    >2p22B (B:)
klnqnqdisqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtq
ytntvdkllkqfkvylnsqnkeesnaitrler

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.