PDB entry 2p1m

View 2p1m on RCSB PDB site
Description: TIR1-ASK1 complex structure
Class: signaling protein
Keywords: F-box, leucine rich repeat, SIGNALING PROTEIN
Deposited on 2007-03-05, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SKP1-like protein 1A
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SKP1A, ASK1, SKP1, UIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p1ma1, d2p1ma2
  • Chain 'B':
    Compound: TRANSPORT INHIBITOR RESPONSE 1 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: TIR1, FBL1, WEI1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p1mA (A:)
    msakkivlkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakvieyck
    rhveaaaskaeavegaatsdddlkawdadfmkidqatlfelilaanylniknlldltcqt
    vadmikgktpeeirttfnikndftpeeeeevrrenqwafe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p1mA (A:)
    lkseavalesqtiaplpnvtskilakvieylilaanylniknlldltcqtvadmikgktp
    eeirttfnikndftpeeeeevrrenqwafe
    

  • Chain 'B':
    No sequence available.