PDB entry 2p15

View 2p15 on RCSB PDB site
Description: Crystal structure of the ER alpha ligand binding domain with the agonist ortho-trifluoromethylphenylvinyl estradiol
Class: hormone receptor
Keywords: nulear receptor, ligand binding domain, helix 12, HORMONE RECEPTOR
Deposited on 2007-03-02, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (240)
    Domains in SCOPe 2.07: d2p15a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (240)
    Domains in SCOPe 2.07: d2p15b_
  • Chain 'C':
    Compound: GRIP peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: GRIP peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EZT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p15A (A:)
    sikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvh
    minwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgk
    cvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhih
    rvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpl
    sdlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p15A (A:)
    slalsltadqmvsalldaeppilyseyrpfseasmmglltnladrelvhminwakrvpgf
    vdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdm
    llatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtli
    hlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldah
    rl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p15B (B:)
    sikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvh
    minwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgk
    cvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhih
    rvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpl
    sdlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p15B (B:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlih
    lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahr
    lh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.