PDB entry 2p12

View 2p12 on RCSB PDB site
Description: Crystal structure of protein of unknown function DUF402 from Rhodococcus sp. RHA1
Class: structural genomics, unknown function
Keywords: APC7392, beta-barrel, Rhodococcus sp. RHA1, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2007-03-01, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein DUF402
    Species: Rhodococcus sp. [TaxId:101510]
    Gene: RHA1_ro00977
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0SI31 (Start-173)
      • modified residue (46)
      • modified residue (125)
      • modified residue (168)
      • cloning artifact (174)
    Domains in SCOPe 2.07: d2p12a1, d2p12a2
  • Chain 'B':
    Compound: Hypothetical protein DUF402
    Species: Rhodococcus sp. [TaxId:101510]
    Gene: RHA1_ro00977
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0SI31 (Start-173)
      • modified residue (46)
      • modified residue (125)
      • modified residue (168)
      • cloning artifact (174)
    Domains in SCOPe 2.07: d2p12b2, d2p12b3
  • Heterogens: ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p12A (A:)
    ghmagashdihppkveyfdlrdhtntdpkgfvrhvdhyrvepwglymartsdhpqfhyle
    swllpdlglrasifhyhpyhqrdqdhyvdigtftrgddvwksedhyldlvvrtgrdtell
    dvdelmeahttglldtataeqailtattaidgiaahghdlgrwlasigmpidwrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p12A (A:)
    ihppkveyfdlrdhtntdpkgfvrhvdhyrvepwglymartsdhpqfhyleswllpdlgl
    rasifhyhpyhqrdqdhyvdigtftrgddvwksedhyldlvvrtgrdtelldvdelmeah
    ttglldtataeqailtattaidgiaahghdlgrwlasigmpidwrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p12B (B:)
    ghmagashdihppkveyfdlrdhtntdpkgfvrhvdhyrvepwglymartsdhpqfhyle
    swllpdlglrasifhyhpyhqrdqdhyvdigtftrgddvwksedhyldlvvrtgrdtell
    dvdelmeahttglldtataeqailtattaidgiaahghdlgrwlasigmpidwrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p12B (B:)
    hppkveyfdlrdhtntdpkgfvrhvdhyrvepwglymartsdhpqfhyleswllpdlglr
    asifhyhpyhqrdqdhyvdigtftrgddvwksedhyldlvvrtgrdtelldvdelmeaht
    tglldtataeqailtattaidgiaahghdlgrwlasigmpidwrg