PDB entry 2p10

View 2p10 on RCSB PDB site
Description: crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution
Class: hydrolase
Keywords: putative phosphonopyruvate hydrolase, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, hydrolase
Deposited on 2007-03-01, released 2007-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mll9387 protein
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: NP_085906.1, mll9387
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981G2
      • modified residue (61)
      • modified residue (83)
      • modified residue (107)
      • modified residue (109)
      • modified residue (146)
      • modified residue (154)
      • modified residue (178)
      • modified residue (190)
      • modified residue (206)
      • modified residue (261)
    Domains in SCOPe 2.08: d2p10a1
  • Chain 'B':
    Compound: Mll9387 protein
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: NP_085906.1, mll9387
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981G2 (Start-285)
      • modified residue (61)
      • modified residue (83)
      • modified residue (107)
      • modified residue (109)
      • modified residue (146)
      • modified residue (154)
      • modified residue (178)
      • modified residue (190)
      • modified residue (206)
      • modified residue (261)
    Domains in SCOPe 2.08: d2p10b1
  • Chain 'C':
    Compound: Mll9387 protein
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: NP_085906.1, mll9387
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981G2
      • modified residue (61)
      • modified residue (83)
      • modified residue (107)
      • modified residue (109)
      • modified residue (146)
      • modified residue (154)
      • modified residue (178)
      • modified residue (190)
      • modified residue (206)
      • modified residue (261)
    Domains in SCOPe 2.08: d2p10c1
  • Chain 'D':
    Compound: Mll9387 protein
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: NP_085906.1, mll9387
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981G2
      • modified residue (61)
      • modified residue (83)
      • modified residue (107)
      • modified residue (109)
      • modified residue (146)
      • modified residue (154)
      • modified residue (178)
      • modified residue (190)
      • modified residue (206)
      • modified residue (261)
    Domains in SCOPe 2.08: d2p10d1
  • Chain 'E':
    Compound: Mll9387 protein
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: NP_085906.1, mll9387
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981G2
      • modified residue (61)
      • modified residue (83)
      • modified residue (107)
      • modified residue (109)
      • modified residue (146)
      • modified residue (154)
      • modified residue (178)
      • modified residue (190)
      • modified residue (206)
      • modified residue (261)
    Domains in SCOPe 2.08: d2p10e1
  • Chain 'F':
    Compound: Mll9387 protein
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: NP_085906.1, mll9387
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981G2
      • modified residue (61)
      • modified residue (83)
      • modified residue (107)
      • modified residue (109)
      • modified residue (146)
      • modified residue (154)
      • modified residue (178)
      • modified residue (190)
      • modified residue (206)
      • modified residue (261)
    Domains in SCOPe 2.08: d2p10f1
  • Heterogens: ACT, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p10A (A:)
    gmstdtcikrptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgry
    rmagrgslagllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkei
    gfagvqnfptvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavama
    kagadilvchmglttggaigarsgksmddcvslinecieaartirddiiilshggpianp
    edarfildscqgchgfygassmerlpaeeairsqtlafkairrqpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p10A (A:)
    krptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgryrmagrgsl
    agllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkeigfagvqnf
    ptvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavamakagadilv
    chmgltgksmddcvslinecieaartirddiiilshggpianpedarfildscqgchgfy
    gassmerlpaeeairsqtlafkairrqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p10B (B:)
    gmstdtcikrptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgry
    rmagrgslagllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkei
    gfagvqnfptvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavama
    kagadilvchmglttggaigarsgksmddcvslinecieaartirddiiilshggpianp
    edarfildscqgchgfygassmerlpaeeairsqtlafkairrqpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p10B (B:)
    rptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgryrmagrgsla
    gllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkeigfagvqnfp
    tvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavamakagadilvc
    hmgltgksmddcvslinecieaartirddiiilshggpianpedarfildscqgchgfyg
    assmerlpaeeairsqtlafkairrqpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p10C (C:)
    gmstdtcikrptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgry
    rmagrgslagllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkei
    gfagvqnfptvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavama
    kagadilvchmglttggaigarsgksmddcvslinecieaartirddiiilshggpianp
    edarfildscqgchgfygassmerlpaeeairsqtlafkairrqpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p10C (C:)
    rptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgryrmagrgsla
    gllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkeigfagvqnfp
    tvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavamakagadilvc
    hmglttrsgksmddcvslinecieaartirddiiilshggpianpedarfildscqgchg
    fygassmerlpaeeairsqtlafkairrqp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p10D (D:)
    gmstdtcikrptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgry
    rmagrgslagllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkei
    gfagvqnfptvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavama
    kagadilvchmglttggaigarsgksmddcvslinecieaartirddiiilshggpianp
    edarfildscqgchgfygassmerlpaeeairsqtlafkairrqpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p10D (D:)
    rptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgryrmagrgsla
    gllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkeigfagvqnfp
    tvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavamakagadilvc
    hmglttgksmddcvslinecieaartirddiiilshggpianpedarfildscqgchgfy
    gassmerlpaeeairsqtlafkairrqp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2p10E (E:)
    gmstdtcikrptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgry
    rmagrgslagllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkei
    gfagvqnfptvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavama
    kagadilvchmglttggaigarsgksmddcvslinecieaartirddiiilshggpianp
    edarfildscqgchgfygassmerlpaeeairsqtlafkairrqpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p10E (E:)
    rptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgryrmagrgsla
    gllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkeigfagvqnfp
    tvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavamakagadilvc
    hmglttrsgksmddcvslinecieaartirddiiilshggpianpedarfildscqgchg
    fygassmerlpaeeairsqtlafkairrq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2p10F (F:)
    gmstdtcikrptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgry
    rmagrgslagllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkei
    gfagvqnfptvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavama
    kagadilvchmglttggaigarsgksmddcvslinecieaartirddiiilshggpianp
    edarfildscqgchgfygassmerlpaeeairsqtlafkairrqpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p10F (F:)
    rptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgryrmagrgsla
    gllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkeigfagvqnfp
    tvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavamakagadilvc
    hmgltgksmddcvslinecieaartirddiiilshggpianpedarfildscqgchgfyg
    assmerlpaeeairsqtlafkairrq