PDB entry 2p0m

View 2p0m on RCSB PDB site
Description: Revised structure of rabbit reticulocyte 15S-lipoxygenase
Class: Oxidoreductase
Keywords: rabbit, 15s-lipoxygenase, twin, pseudo symmetry, conformational change, arachidonate, iron, Oxidoreductase
Deposited on 2007-02-28, released 2007-10-09
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-09, with a file datestamp of 2007-10-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arachidonate 15-lipoxygenase
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2p0ma1, d2p0ma2
  • Chain 'B':
    Compound: Arachidonate 15-lipoxygenase
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2p0mb1, d2p0mb2
  • Heterogens: FE2, RS7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p0mA (A:)
    gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
    fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvgtgcttvgdp
    qglfqkhreqeleerrklyqwgswkeglilnvagskltdlpvderfledkkidfeaslaw
    glaelalknslnilapwktlddfnrifwcgrsklarrvrdswqedslfgyqflnganpml
    lrrsvqlparlvfppgmeelqaqlekelkagtlfeadfalldnikanvilycqqylaapl
    vmlklqpdgklmpmviqlhlpkigssppplflptdppmvwllakcwvrssdfqvhelnsh
    llrghlmaevftvatmrclpsihpvfklivphlrytleinvrarnglvsdfgifdqimst
    gggghvqllqqagafltyrsfcppddladrgllgvessfyaqdalrlweiisryvqgimg
    lyyktdeavrddlelqswcreiteiglqgaqkqgfptslqsvaqachfvtmciftctgqh
    ssihlgqldwftwvpnapctmrlpppttkdatletvmatlpnlhqsslqmsivwqlgrdq
    pimvplgqhqeeyfsgpepravlekfreelaimdkeievrnekldipyeylrpsivensv
    ai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p0mB (B:)
    gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
    fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvgtgcttvgdp
    qglfqkhreqeleerrklyqwgswkeglilnvagskltdlpvderfledkkidfeaslaw
    glaelalknslnilapwktlddfnrifwcgrsklarrvrdswqedslfgyqflnganpml
    lrrsvqlparlvfppgmeelqaqlekelkagtlfeadfalldnikanvilycqqylaapl
    vmlklqpdgklmpmviqlhlpkigssppplflptdppmvwllakcwvrssdfqvhelnsh
    llrghlmaevftvatmrclpsihpvfklivphlrytleinvrarnglvsdfgifdqimst
    gggghvqllqqagafltyrsfcppddladrgllgvessfyaqdalrlweiisryvqgimg
    lyyktdeavrddlelqswcreiteiglqgaqkqgfptslqsvaqachfvtmciftctgqh
    ssihlgqldwftwvpnapctmrlpppttkdatletvmatlpnlhqsslqmsivwqlgrdq
    pimvplgqhqeeyfsgpepravlekfreelaimdkeievrnekldipyeylrpsivensv
    ai