PDB entry 2ozz

View 2ozz on RCSB PDB site
Description: Crystal structure of YhfZ from Shigella flexneri
Class: structural genomics, unknown function
Keywords: alpha-beta structure, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2007-02-28, released 2007-03-27
The last revision prior to the SCOP 1.75 freeze date was dated 2007-03-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yhfZ
    Species: Shigella flexneri 2a
    Gene: yhfZ, SF3401, S_4361
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83JA6 (3-230)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (21)
      • modified residue (50)
      • modified residue (67)
      • modified residue (126)
      • modified residue (170)
      • modified residue (201)
    Domains in SCOP 1.75: d2ozza1
  • Chain 'B':
    Compound: Hypothetical protein yhfZ
    Species: Shigella flexneri 2a
    Gene: yhfZ, SF3401, S_4361
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83JA6 (Start-230)
      • modified residue (21)
      • modified residue (50)
      • modified residue (67)
      • modified residue (126)
      • modified residue (170)
      • modified residue (201)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ozzA (A:)
snamdnkallshvdinnvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirvec
llngvydmavvsrlaaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsr
sadqkimtdvffgdsdvervdlsyheslqrivkgdvdaviwnvvaeneltmlgleatplt
ddprflqateavvltrvddypmqqllravvdkhallahqqrvvsgeqepsy

    Sequence, based on observed residues (ATOM records): (download) 
    >2ozzA (A:)
snamdnkallshvdinnvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirvec
llngvydmavvsrlaaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsr
sadqkimtdvffgdsdvervdlsyheslqrivkgdvdaviwnvaeneltmlgleatpltd
dprflqateavvltrvddypmqqllravvdkhallahqqrvvsgeqepsy

  • Chain 'B':
    No sequence available.