PDB entry 2ozw

View 2ozw on RCSB PDB site
Description: Solution structure of human phosphohistidine phosphatase 1 with phosphate ligand
Class: hydrolase
Keywords: alpha/beta architecture, addition of phosphate ligand, HYDROLASE
Deposited on 2007-02-27, released 2008-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 14 kDa phosphohistidine phosphatase
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NRX4 (0-124)
  Domains in SCOPe 2.08: d2ozwa_
• Heterogens: PO4

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ozwA (A:)
  mavadlalipdvdidsdgvfkyvlirvhsaprsgapaaeskeivrgykwaeyhadiydkv
  sgdmqkqgcdceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtw
  andgy