PDB entry 2ozu

View 2ozu on RCSB PDB site
Description: Crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A
Class: transferase
Keywords: histone acetyltransferase, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2007-02-27, released 2007-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase MYST3
    Species: Homo sapiens [TaxId:9606]
    Gene: MYST3, MOZ, RUNXBP2, ZNF220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92794
      • modified residue (107)
    Domains in SCOPe 2.06: d2ozua1
  • Heterogens: ZN, ACO, ACM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ozuA (A:)
    gvtgppdpqvrcpsviefgkyeihtwysspypqeysrlpklylcefclkymksrtilqqh
    mkkcgwfhppaneiyrknnisvfevdgnvstiycqnlcllaklfldhktlyydvepflfy
    vltqndvkgchlvgyfskekhcqqkynvscimilpqyqrkgygrflidfsyllskregqa
    gspekplsdlgrlsymaywksvileclyhqndkqisikklskltgicpqditstlhhlrm
    ldfrsdqfviirrekliqdhmaklqlnlrpvdvdpeclrwtpvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ozuA (A:)
    rcpsviefgkyeihtwysspypqeysrlpklylcefclkymksrtilqqhmkkcgwfhpp
    aneiyrknnisvfevdgnvstiycqnlcllaklfldhktlyydvepflfyvltqndvkgc
    hlvgyfskekhcqqkynvscimilpqyqrkgygrflidfsyllskregqagspekplsdl
    grlsymaywksvileclyhqsikklskltgicpqditstlhhlrmlirrekliqdhmakl
    qlrpvdvdpeclrw