PDB entry 2ozj

View 2ozj on RCSB PDB site
Description: crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution
Class: unknown function
Keywords: cupin superfamily protein, cupin 2, conserved barrel, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, unknown function
Deposited on 2007-02-26, released 2007-03-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.184
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cupin 2, conserved barrel
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: EAT53321.1, Dhaf_2995
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18ZY6 (1-End)
      • modified residue (1)
      • modified residue (29)
      • modified residue (86)
      • modified residue (103)
    Domains in SCOPe 2.01: d2ozja_
  • Chain 'B':
    Compound: Cupin 2, conserved barrel
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: EAT53321.1, Dhaf_2995
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18ZY6
      • modified residue (29)
      • modified residue (86)
      • modified residue (103)
    Domains in SCOPe 2.01: d2ozjb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ozjA (A:)
    gmarlknlpqerplplasliearenqvlsmalaqsdrvqislfsfadgesvseeeyfgdt
    lylilqgeavitfddqkidlvpedvlmvpahkihaiagkgrfkmlqitlideer
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ozjA (A:)
    marlknlpqerplplasliearenqvlsmalaqsdrvqislfsfadgesvseeeyfgdtl
    ylilqgeavitfddqkidlvpedvlmvpahkihaiagkgrfkmlqitlid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ozjB (B:)
    gmarlknlpqerplplasliearenqvlsmalaqsdrvqislfsfadgesvseeeyfgdt
    lylilqgeavitfddqkidlvpedvlmvpahkihaiagkgrfkmlqitlideer
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ozjB (B:)
    arlknlpqerplplasliearenqvlsmalaqsdrvqislfsfadgesvseeeyfgdtly
    lilqgeavitfddqkidlvpedvlmvpahkihaiagkgrfkmlqitlid