PDB entry 2ozb

View 2ozb on RCSB PDB site
Description: Structure of a human Prp31-15.5K-U4 snRNA complex
Class: RNA binding protein/RNA
Keywords: RNA-protein complex, ribonucleoprotein particle (RNP), pre-mRNA splicing, U4/U6 di-snRNA, U4/U6 di-snRNP, hierarchical assembly, Nop domain, RNP-binding domain, RNA BINDING PROTEIN-RNA COMPLEX
Deposited on 2007-02-26, released 2007-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.208
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U4/U6.U5 tri-snRNP 15.5 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NHP2L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ozba1
  • Chain 'B':
    Compound: U4/U6 small nuclear ribonucleoprotein Prp31
    Species: Homo sapiens [TaxId:9606]
    Gene: PRPF31, PRP31
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ozbb1
  • Chain 'C':
    Compound: RNA comprising the 5' Stem-Loop RNA of U4snRNA
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: U4/U6.U5 tri-snRNP 15.5 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NHP2L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ozbd1
  • Chain 'E':
    Compound: U4/U6 small nuclear ribonucleoprotein Prp31
    Species: Homo sapiens [TaxId:9606]
    Gene: PRPF31, PRP31
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ozbe_
  • Chain 'F':
    Compound: RNA comprising the 5' Stem-Loop RNA of U4snRNA
    Species: synthetic, synthetic
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ozbA (A:)
    gsmteadvnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaa
    daepleiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqs
    iqqsierllv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ozbA (A:)
    eadvnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaep
    leiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqs
    ierllv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ozbB (B:)
    gplgsevmgpveaapeyrvivdannltveienelniihkfirdkyskrfpeleslvpnal
    dyirtvkelgnsldkcknnenlqqiltnatimvvsvtasttqgqqlseeelerleeacdm
    alelnaskhriyeyvesrmsfiapnlsiiigastaakimgvaggltnlskmpacnimllg
    aqrktlsgfsstsvlphtgyiyhsdivqslppdlrrkaarlvaakctlaarvdsfheste
    gkvgyelkdeierkfdkwqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ozbB (B:)
    eaapeyrvivdannltveienelniihkfirdkyskrfpeleslvpnaldyirtvkelgn
    sldkcknnenlqqiltnatimvvsvtasttqgqqlseeelerleeacdmalelnaskhri
    yeyvesrmsfiapnlsiiigastaakimgvaggltnlskmpacnimllgaqsvlphtgyi
    yhsdivqslppdlrrkaarlvaakctlaarvdsfhestegkvgyelkdeierkfdkwqe
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ozbD (D:)
    gsmteadvnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaa
    daepleiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqs
    iqqsierllv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ozbD (D:)
    advnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaepl
    eiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsi
    erllv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ozbE (E:)
    gplgsevmgpveaapeyrvivdannltveienelniihkfirdkyskrfpeleslvpnal
    dyirtvkelgnsldkcknnenlqqiltnatimvvsvtasttqgqqlseeelerleeacdm
    alelnaskhriyeyvesrmsfiapnlsiiigastaakimgvaggltnlskmpacnimllg
    aqrktlsgfsstsvlphtgyiyhsdivqslppdlrrkaarlvaakctlaarvdsfheste
    gkvgyelkdeierkfdkwqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ozbE (E:)
    eaapeyrvivdannltveienelniihkfirdkyskrfpeleslvpnaldyirtvkelgn
    sldkcknnenlqqiltnatimvvsvtasttqgqqlseeelerleeacdmalelnaskhri
    yeyvesrmsfiapnlsiiigastaakimgvaggltnlskmpacnimllgaqrsvlphtgy
    iyhsdivqslppdlrrkaarlvaakctlaarvdsfhestegkvgyelkdeierkfdkwqe
    

  • Chain 'F':
    No sequence available.