PDB entry 2oz5

View 2oz5 on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis protein tyrosine phosphatase PtpB in complex with the specific inhibitor OMTS
Class: structural genomics, unknown function
Keywords: Protein tyrosine phosphatase in complex with small molecule inhibitor, Structural Genomics, TB Structural Genomics Consortium, TBSGC, UNKNOWN FUNCTION
Deposited on 2007-02-23, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotyrosine protein phosphatase ptpb
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: ptpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oz5a_
  • Chain 'B':
    Compound: phosphotyrosine protein phosphatase ptpb
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: ptpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oz5b_
  • Heterogens: 7XY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oz5A (A:)
    mgsshhhhhhssglvprgshmavrelpgawnfrdvadtatalrpgrlfrsselsrlddag
    ratlrrlgitdvadlrssrevarrgpgrvpdgidvhllpfpdladddaddsaphetafkr
    lltndgsngesgessqsindaatrymtdeyrqfptrngaqralhrvvtllaagrpvlthc
    fagkdrtgfvvalvleavgldrdvivadylrsndsvpqlrarisemiqqrfdtelapevv
    tftkarlsdgvlgvraeylaaarqtidetygslggylrdagisqatvnrmrgvllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oz5A (A:)
    relpgawnfrdvadtatalrpgrlfrsselsrlddagratlrrlgitdvadlrssrevar
    rgpgrvpdgidvhllpfpdladdaddsaphetafkrlltngessqsindaatrymtdeyr
    qfptrngaqralhrvvtllaagrpvlthcfagkdrtgfvvalvleavgldrdvivadylr
    sndsvpqlrarisemiqqrfdtelapevvtftkarlsdgvlgvraeylaaarqtidetyg
    slggylrdagisqatvnrmrgvllg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oz5B (B:)
    mgsshhhhhhssglvprgshmavrelpgawnfrdvadtatalrpgrlfrsselsrlddag
    ratlrrlgitdvadlrssrevarrgpgrvpdgidvhllpfpdladddaddsaphetafkr
    lltndgsngesgessqsindaatrymtdeyrqfptrngaqralhrvvtllaagrpvlthc
    fagkdrtgfvvalvleavgldrdvivadylrsndsvpqlrarisemiqqrfdtelapevv
    tftkarlsdgvlgvraeylaaarqtidetygslggylrdagisqatvnrmrgvllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oz5B (B:)
    relpgawnfrdvadtatalrpgrlfrsselsrlddagratlrrlgitdvadlrssrevar
    rgpgrvpdgidvhllpfpdladddaddsaphetafkrlltnsindaatrymtdeyrqfpt
    rngaqralhrvvtllaagrpvlthcfagkdrtgfvvalvleavgldrdvivadylrsnds
    vpqlrarisemiqqrfdtelapevvtftkarlsdgvlgvraeylaaarqtidetygslgg
    ylrdagisqatvnrmrgvllg