PDB entry 2oz4

View 2oz4 on RCSB PDB site
Description: Structural Plasticity in IgSF Domain 4 of ICAM-1 Mediates Cell Surface Dimerization
Class: cell adhesion
Keywords: igsf domain, structural plasticity, cell-surface dimerization, cell adhesion
Deposited on 2007-02-23, released 2007-10-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intercellular adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ICAM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2oz4a1, d2oz4a2, d2oz4a3
  • Chain 'H':
    Compound: Fab fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2oz4h1
  • Chain 'L':
    Compound: Fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2oz4l1, d2oz4l2
  • Heterogens: NAG, SO4, ZN, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oz4A (A:)
    vlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygndsfsa
    kasvsvtaedegtqrltcavilgnqsqetlqtvtiysfpapnviltkpevsegtevtvkc
    eahprakvtlngvpaqplgpraqlllkatpedngrsfscsatlevagqlihknqtrelrv
    lygprlderdcpgnwtwpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdle
    gtylcrarstqgevtrevtvnvlsp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2oz4H (H:)
    evqlqqsgpelvqpgasvkiscktsgytfseftmhwvkqshgkslewiggintinggssy
    kqsfkdkatltvdkssstaymelnsltsedsavyycatkgfaywgqgtlvtvsaakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oz4H (H:)
    evqlqqsgpelvqpgasvkiscktsgytfseftmhwvkqshgkslewiggintinggssy
    kqsfkdkatltvdkssstaymelnsltsedsavyycatkgfaywgqgtlvtvsaakttpp
    svyplapnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvps
    stwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oz4L (L:)
    dilltqspailsvspgervsfscrasqsigtsihwfqqringsprllieyasesisgips
    rfsgsgsgtdftltinsvesediadyycqqsnvwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec