PDB entry 2oz0

View 2oz0 on RCSB PDB site
Description: Mechanistic and Structural Studies of H373Q Flavocytochrome b2: Effects of Mutating the Active Site Base
Class: oxidoreductase
Keywords: Flavocytochrome b2, FMN, Pyruvate, OXIDOREDUCTASE
Deposited on 2007-02-23, released 2007-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00175
      • engineered (372)
    Domains in SCOPe 2.08: d2oz0a1, d2oz0a2
  • Chain 'B':
    Compound: Cytochrome b2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00175
      • engineered (372)
    Domains in SCOPe 2.08: d2oz0b_
  • Heterogens: HEM, FMN, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oz0A (A:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnqggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oz0A (A:)
    pkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtai
    feplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppldn
    iinlydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdist
    dmlgshvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiiea
    apsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnga
    sralskfidpsltwkdieelkkktklpivikgvqrtedvikaaeigvsgvvlsnqggrql
    dfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkalclgakgvglgrpflya
    nscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlstlkartvgvpndvlyne
    vyegptltefed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oz0B (B:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnqggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oz0B (B:)
    apgetkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthren
    hnayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcg
    qgvtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkal
    fvtvdapslgqrekdmklkfsngasralskfidpsltwkdieelkkktklpivikgvqrt
    edvikaaeigvsgvvlsnqggrqldfsrapievlaetmpileqrnlkdklevfvdggvrr
    gtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelk
    pdlldlstlkartvgvpndvlynevyegptltefed