PDB entry 2oys

View 2oys on RCSB PDB site
Description: Crystal Structure of SP1951 protein from Streptococcus pneumoniae in complex with FMN, Northeast Structural Genomics Target SpR27
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2007-02-22, released 2007-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein SP1951
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP_1951
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97NR6
      • modified residue (143)
      • modified residue (166)
      • modified residue (210)
    Domains in SCOPe 2.08: d2oysa_
  • Chain 'B':
    Compound: Hypothetical protein SP1951
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP_1951
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97NR6
      • modified residue (143)
      • modified residue (166)
      • modified residue (210)
    Domains in SCOPe 2.08: d2oysb_
  • Heterogens: FMN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oysA (A:)
    mnkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkg
    idrqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvv
    tldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegk
    ikykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyveniklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oysA (A:)
    nkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkgi
    drqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvvt
    ldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegki
    kykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oysB (B:)
    mnkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkg
    idrqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvv
    tldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegk
    ikykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyveniklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oysB (B:)
    nkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkgi
    drqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvvt
    ldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegki
    kykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyve