PDB entry 2oyf

View 2oyf on RCSB PDB site
Description: Crystal Structure of the complex of phospholipase A2 with indole acetic acid at 1.2 A resolution
Class: Hydrolase
Keywords: phospholipase A2, indole acetic acid, crytsal structure, daboia ruselli pulchella, Hydrolase
Deposited on 2007-02-22, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.189
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 VRV-PL-VIIIa
  Species: Daboia russellii pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-120)
  Domains in SCOPe 2.07: d2oyfa_
• Heterogens: SO4, IAC, ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oyfA (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c