PDB entry 2oye

View 2oye on RCSB PDB site
Description: Indomethacin-(R)-alpha-ethyl-ethanolamide bound to Cyclooxygenase-1
Class: oxidoreductase
Keywords: COX, PGHS, indomethacin, NSAID, heme, OXIDOREDUCTASE
Deposited on 2007-02-21, released 2007-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: Prostaglandin G/H synthase 1
    Species: Ovis aries [TaxId:9940]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05979
      • see remark 999 (91)
    Domains in SCOPe 2.07: d2oyep1, d2oyep2
  • Heterogens: NAG, NDG, BMA, BOG, FLC, HEM, IM8, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2oyeP (P:)
    msrqsislrfpllllllspspvfsadpgapapvnpccyypcqhqgicvrfgldryqcdct
    rtgysgpnctipeiwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvr
    snlipspptyniahdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrr
    fllrrkfipdpqgtnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnler
    qyqlrlfkdgklkyqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglml
    yatiwlrehnrvcdllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlk
    fdpellfgaqfqyrnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygve
    alvdafsrqpagrigggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqe
    ltgekemaaeleelygdidalefypglllekchpnsifgesmiemgapfslkgllgnpic
    speywkastfggevgfnlvktatlkklvclntktcpyvsfhvpdprqedrpgverpptel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oyeP (P:)
    pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihf
    llthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytri
    lpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffk
    tsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapv
    lmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqt
    arliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhplm
    pdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdv
    ikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllek
    chpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvcln
    tktcpyvsfhvpd