PDB entry 2oya
View 2oya on RCSB PDB site
Description: Crystal structure analysis of the dimeric form of the SRCR domain of mouse MARCO
Class: ligand binding protein
Keywords: Extracellular matrix, Scavenger receptor cysteine-rich (SRCR), macrophage receptor, ligand binding, basic cluster, acidic cluster, sulfate binding, dimer, LIGAND BINDING PROTEIN
Deposited on
2007-02-21, released
2007-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated
2021-03-31, with a file datestamp of
2021-03-26.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Macrophage receptor MARCO
Species: Mus musculus [TaxId:10090]
Gene: Marco
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2oyaa1, d2oyaa2 - Chain 'B':
Compound: Macrophage receptor MARCO
Species: Mus musculus [TaxId:10090]
Gene: Marco
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2oyab1, d2oyab2 - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2oyaA (A:)
aplaqrvrimggtnrgraevyynnewgticdddwdnndatvfcrmlgysrgralssyggg
sgniwldnvncrgtenslwdcsknswgnhncvhnedagvecs
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2oyaB (B:)
aplaqrvrimggtnrgraevyynnewgticdddwdnndatvfcrmlgysrgralssyggg
sgniwldnvncrgtenslwdcsknswgnhncvhnedagvecs