PDB entry 2oy4

View 2oy4 on RCSB PDB site
Description: Uninhibited human MMP-8
Class: hydrolase
Keywords: MMP-8, Matrix Metalloproteinase, HYDROLASE
Deposited on 2007-02-21, released 2007-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.231
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP8, CLG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2oy4a_
  • Chain 'F':
    Compound: Neutrophil collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP8, CLG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2oy4f_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oy4A (A:)
    npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
    rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
    lahssdpgalmypnyafretsnyslpqddidgiqaiyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oy4A (A:)
    pkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyqr
    dhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslgl
    ahssdpgalmypnyafretsnyslpqddidgiqaiyg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2oy4F (F:)
    npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
    rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
    lahssdpgalmypnyafretsnyslpqddidgiqaiyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oy4F (F:)
    pkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyqr
    dhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslgl
    ahssdpgalmypnyafretsnyslpqddidgiqaiyg