PDB entry 2oxz

View 2oxz on RCSB PDB site
Description: Human MMP-12 in complex with two peptides PQG and IAG
Class: hydrolase
Keywords: MMP-12, Matrix Metalloproteinase
Deposited on 2007-02-21, released 2007-03-06
The last revision prior to the SCOP 1.73 freeze date was dated 2007-03-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: HOMO SAPIENS
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • engineered (66)
    Domains in SCOP 1.73: d2oxza1
  • Chain 'X':
    Compound: ILE-ALA-GLY peptide
  • Chain 'Y':
    Compound: PRO-GLN-GLY peptide
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oxzA (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oxzA (A:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptykyvdintfrlsaddirgiqslyg
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.