PDB entry 2oxs

View 2oxs on RCSB PDB site
Description: Crytal Structure of the trypsin complex with benzamidine at high temperature (35 C)
Class: hydrolase
Keywords: trypsin, benzamidine, high temperature, crystsl structure
Deposited on 2007-02-21, released 2007-03-13
The last revision prior to the SCOP 1.75 freeze date was dated 2007-03-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.155
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2oxsa1
  • Heterogens: CA, SO4, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2oxsA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn